PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013587010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 163aa    MW: 18060.7 Da    PI: 8.1233
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013587010.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601439.2e-45131121100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC++dCv+apyfpa++p kfa+vhk+FGasnv+k+l+ l+e+ r+da++s+vyeA+ar++dPvyG+vg+i++lq+qle+l+++la
  XP_013587010.1  13 PCAACKLLRRKCVEDCVFAPYFPAKEPYKFAIVHKIFGASNVSKMLQVLSENYRSDAVNSIVYEANARVQDPVYGCVGIISSLQRQLETLQTQLA 107
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                      +++e
  XP_013587010.1 108 FAQAE 112
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.43612113IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-4313110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MRRNGHSHGA VSPCAACKLL RRKCVEDCVF APYFPAKEPY KFAIVHKIFG ASNVSKMLQV  60
LSENYRSDAV NSIVYEANAR VQDPVYGCVG IISSLQRQLE TLQTQLAFAQ AELVHMKTLH  120
RIDTKPPPYM ASGISFPANK DLSNDVDMAF AYENGAGESL WSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587010.11e-121PREDICTED: LOB domain-containing protein 3-like
SwissprotQ9SA512e-97LBD3_ARATH; LOB domain-containing protein 3
TrEMBLA0A0D3CAT41e-121A0A0D3CAT4_BRAOL; Uncharacterized protein
STRINGBra026042.1-P1e-119(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16530.12e-88ASYMMETRIC LEAVES 2-like 9